<?xml version="1.0" encoding="UTF-8"?><rss version="2.0"
	xmlns:content="http://purl.org/rss/1.0/modules/content/"
	xmlns:wfw="http://wellformedweb.org/CommentAPI/"
	xmlns:dc="http://purl.org/dc/elements/1.1/"
	xmlns:atom="http://www.w3.org/2005/Atom"
	xmlns:sy="http://purl.org/rss/1.0/modules/syndication/"
	xmlns:slash="http://purl.org/rss/1.0/modules/slash/"
	>

<channel>
	<title>Sanskrit Archives - SCSVMV Deemed to be University</title>
	<atom:link href="https://kanchiuniv.ac.in/category/team/sanskrit/feed/" rel="self" type="application/rss+xml" />
	<link>https://kanchiuniv.ac.in/category/team/sanskrit/</link>
	<description></description>
	<lastBuildDate>Thu, 18 Jul 2024 10:15:01 +0000</lastBuildDate>
	<language>en-US</language>
	<sy:updatePeriod>
	hourly	</sy:updatePeriod>
	<sy:updateFrequency>
	1	</sy:updateFrequency>
	<generator>https://wordpress.org/?v=7.0</generator>
	<item>
		<title>Dr.K.S.SIVAKUMAR</title>
		<link>https://kanchiuniv.ac.in/team/dr-k-s-sivakumar/?utm_source=rss&#038;utm_medium=rss&#038;utm_campaign=dr-k-s-sivakumar</link>
		
		<dc:creator><![CDATA[Admin]]></dc:creator>
		<pubDate>Tue, 30 Mar 2021 06:54:40 +0000</pubDate>
				<category><![CDATA[Sanskrit]]></category>
		<category><![CDATA[Team]]></category>
		<guid isPermaLink="false">https://kanchiuniv.ac.in/?p=3823</guid>

					<description><![CDATA[<p>Assistant Professor</p>
<p>The post <a href="https://kanchiuniv.ac.in/team/dr-k-s-sivakumar/">Dr.K.S.SIVAKUMAR</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></description>
										<content:encoded><![CDATA[<div class="wprt-container">		<div data-elementor-type="wp-post" data-elementor-id="3823" class="elementor elementor-3823" data-elementor-post-type="post">
						<section class="elementor-section elementor-top-section elementor-element elementor-element-14b9451 elementor-section-height-min-height elementor-section-items-bottom elementor-section-content-bottom elementor-section-boxed elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="14b9451" data-element_type="section" data-e-type="section" data-settings="{&quot;background_background&quot;:&quot;classic&quot;}">
							<div class="elementor-background-overlay"></div>
							<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-16e8e23" data-id="16e8e23" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-bf03cb7 elementor-widget elementor-widget-heading" data-id="bf03cb7" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">DR.K.S SIVAKUMAR</h2>				</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-6ef17eb elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="6ef17eb" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-9c7d532" data-id="9c7d532" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-ec01236 elementor-widget elementor-widget-spacer" data-id="ec01236" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-16b3618 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="16b3618" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-7de353b" data-id="7de353b" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<section class="elementor-section elementor-inner-section elementor-element elementor-element-0e6f2e8 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="0e6f2e8" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-b83c8dd" data-id="b83c8dd" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-2586a5c elementor-widget elementor-widget-image" data-id="2586a5c" data-element_type="widget" data-e-type="widget" data-widget_type="image.default">
				<div class="elementor-widget-container">
															<img decoding="async" width="164" height="214" src="https://kanchiuniv.ac.in/wp-content/uploads/2021/03/10310.jpg" class="attachment-large size-large wp-image-3824" alt="" />															</div>
				</div>
					</div>
		</div>
				<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-e04eb97" data-id="e04eb97" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-37ac925 elementor-widget elementor-widget-heading" data-id="37ac925" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">DR.K.S SIVAKUMAR</h2>				</div>
				</div>
				<div class="elementor-element elementor-element-3bc6485 elementor-widget elementor-widget-text-editor" data-id="3bc6485" data-element_type="widget" data-e-type="widget" data-widget_type="text-editor.default">
				<div class="elementor-widget-container">
									<p>Assistant Professor<br /><em style="font-size: 15px;">Contact : 044 27264301, 252<br /></em><span style="font-size: 15px;">Email: <a href="mailto:drkssivakumar@kanchiuniv.ac.in">drkssivakumar@kanchiuniv.ac.in</a></span></p>								</div>
				</div>
					</div>
		</div>
					</div>
		</section>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-a799d8b elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="a799d8b" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-87b58a1" data-id="87b58a1" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-d92c390 elementor-widget elementor-widget-accordion" data-id="d92c390" data-element_type="widget" data-e-type="widget" data-widget_type="accordion.default">
				<div class="elementor-widget-container">
							<div class="elementor-accordion">
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2271" class="elementor-tab-title" data-tab="1" role="button" aria-controls="elementor-tab-content-2271" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PROFILE</a>
					</div>
					<div id="elementor-tab-content-2271" class="elementor-tab-content elementor-clearfix" data-tab="1" role="region" aria-labelledby="elementor-tab-title-2271"><p class="textp">Economics : M.A , M.Phil<br>Philosophy : M.A, UGC(NET/JRF) , Ph.D<br>Management- MBA (HR)</p>
<p></p>
<p class="textp">His area of interest lies in the domain of Philosophy, Soft skills, Economics and Management studies.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2272" class="elementor-tab-title" data-tab="2" role="button" aria-controls="elementor-tab-content-2272" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">TEACHING</a>
					</div>
					<div id="elementor-tab-content-2272" class="elementor-tab-content elementor-clearfix" data-tab="2" role="region" aria-labelledby="elementor-tab-title-2272"><p>Indian Culture, Economics and Soft skills facilitation</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2273" class="elementor-tab-title" data-tab="3" role="button" aria-controls="elementor-tab-content-2273" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PUBLICATIONS</a>
					</div>
					<div id="elementor-tab-content-2273" class="elementor-tab-content elementor-clearfix" data-tab="3" role="region" aria-labelledby="elementor-tab-title-2273"><h5>books</h5>
<p class="textp">Economic Man (Homo Economicus) and Advaita Vedanta, Notion Press, Chennai, 2018.</p>
<h5>Conferences</h5>
<p class="textp">• Presented a paper titled: A Study on Effective Social Entrepreneurship in the Light of the Bhagavad Gita, in the UGC Sponsored Two-day International Conference on “Business Leadership, Innovation and Entrepreneurship”, organized by the Department of Management Studies, University of Madras, Chennai, during February 8th &amp; 9th, 2019.</p>
<p>• Presented a paper titled: On Revisiting the Ethical Structure of Economics in the Light of Advaita Vedanta, in the ICSSR Sponsored Two-day International Conference on “Society and Management”, organized by the Indian Institute of Management Kozhikode, at IIM Kozhikode, during December 07-08, 2018.</p>
<p>• Presented a paper titled: The concept of Mind in the Philosophy of Advaita Vedanta, in the ICPR Sponsored Two-day National Seminar on “Phenomenology of mind and Consciousness: Indian &amp; Western Perspective”, organized by the Department of Philosophy, University of Madras, Chennai, during 14th &amp; 15th November 2018.</p>
<p>• Presented a paper titled: “On Self Governance for Corporate Governance-in the light of the Bhagavad Gita ” in the Two Day International Seminar on “Corporate Governance: Issues and Challenges” organized jointly by the Bharathidasan University and the Shrimati Indira Gandhi College, Tiruchirappalli, 18-19 June 2018.</p>
<p>• Presented a paper titled “Individual Development-in the light of Bhagavad Gita”, in the National Conference on “Multifaceted Approach towards New India”, organized by the Faculty of Management Studies, Commerce &amp; HR, SCSVMV University, Kanchipuram, 10th November 2017.</p>
<p>• Presented a paper titled “ Swami Vivekananda’s Perception of the Sanskrit Language”, in the two-day National Seminar on Continuing Creative Efforts for the Sustenance of Sanskrit, organized by the Department of Sanskrit and Indian Culture, SCSVMV University, Kanchipuram, 03-04 March 2016.</p>
<p>• Presented a paper titled: “On understanding Rasa in the Tradition of Advaita Vedanta” in the two day National Seminar on Rasa Theory, Organized by the Department of Sanskrit and Indian Culture, SCSVMV University, Kanchipuram, 27-28 March, 2014.</p>
<p>• Presented a paper titled : “ The Philosophical base of Advaita Vedanta and its Relevance to present day students” in the two day National Seminar on Philosophical Foundations of Education in Ancient India and its relevance to present day context, organized by the School of Education, SCSVMV University, Kanchipuram, 29-30 November 2013.</p>
<p>• Presented a paper titled: “Taxation and Vicious Circle of Poverty”,in the UGC Sponsored National Level Seminar on “Liberalization Perspective of Public Expenditure in India”, organized by Rajah Serfogi Government College(Autonomous), Thanjavur, 27-28 April 2013.</p>
<p>• Presented a paper titled: “A Synthesized Ethical Structure of Economics for the Emerging New World Economic Order”, in the UGC Sponsored National Conference on “Prospects and Policy Challenges of India in the Recession Period”, organized by Government Arts College(Autonomous), Kumbakonam, 12-13 April 2013.</p>
<p>• Presented a paper titled: On Supply Chain Management,in the UGC Sponsored Two day national conference on “Recent Trends in Management practice ”, organized by Rajah Serfogi Government College(Autonomous), Thanjavur, 25-26 February 2013.</p>
<p>• Presented a paper titled: On the Ethical Understanding of Tattvamsi, in the 86th session of Indian Philosophical Congress, Organized by the Annamalai University, 16-19 December 2011.</p>
<p>• Presented a paper titled: “On the Limiting Factors in the Ethical Structure of Economics” in the Third International conference on Management Research organized jointly by the Bharathidasan Institute of Management, Tiruchirappalli and Centre for Contemporary Management Research, 14-15 Feb.2009.</p>
<p>• Presented a paper titled: “On the Financial Dimension of HR in Acquisitions with Reference to Retention of Key Talent” in the Two Day International Seminar on “Emerging Paradigm in Financial Services” organized jointly by the Bharathidasan University and the Cauvery College for Women, Tiruchirappalli, 07-08April 2007.</p>
<p>• Presented a paper titled: “On Redefining the Concept of Economic Rationality” in the Second National Conference on Management Science and Practice, organized jointly by the Indian Institute of Management, Ahmedabad and the Indian Institute of Technology, Madras, 09-11March 2007.</p>
<p>• Presented a paper titled” “On Case study as a Learner Oriented Method of Teaching” in the UGC sponsored Two Day International Seminar on “Case Study Method of Teaching in Commerce / Management Education” organized by the Bharathidasan University, Tiruchirappalli, 20-21 January 2007.</p>
<p>• Presented a paper titled: “On the Non- Maximization Factors Effecting Consumer Behaviour” in the International Conference on “Marketing in the Age of Convergence” organized by the Indian Institute of Management, Kozhikode, 07-08 January 2006.</p>
<p>• Presented a paper titled: “Distribution Services: Indian and the GATS 2000 Negotiations” in the UGC Sponsored National Seminar on Problems and Prospects of Service Sector in India in the Context of WTO’s GATS Proposals, organized by Jamal Mohamed College (Autonomous), Tiruchirappalli. 08-10 November 2005.</p>
<p>• Presented a paper titled: “On the Ethical Philosophy of Economics” in the International Conference on “Business Economics and Finance (ICBEF 2005)” organized by the Adaikalamatha Instituted of Management, Thanjavur,29-30 September 2005.</p>
<p>• Presented a paper titled: “Youth and Real Personality Development” in the National Conference on “Youth Empowerment, Employment, Peace and Food”, organized by SASTRA Deemed University, SRC, Kumbakonam, 4th September 2005.</p>
<p>• Presented a paper titled: “Concept of Faith and Reason in Advaita Vedanta” in the 68th Session of Indian Philosophical Congress, organized by the H.N.B. Garwal University, Srinagar Garhwal, 21-23 October 1993.</p>
<h5>Journals</h5>
<p class="textp">• Published a paper titled: A Study on Effective Social Entrepreneurship in the Light of the Bhagavad Gita, in the International Multidisciplinary Quarterly Research Journal- AJANTA,(ISSN 2277-5730), Vol.III, Issue 1, January-March 2019, pp.148-153.</p>
<p>• Published a paper titled: The Crisis of Economic Man (Homo Economicus), in the International Journal of Humanities and Social Sciences (IJHSS), (ISSN 2250-3226), Vol.8, Number1, 2018, pp.51-54.</p>
<p>• Published an article titled “Individual Development in the light of the Bhagavad Gita”, in The IUP Journal of Soft Skills (ISSN: 0973-8479) ICFAI Publications, Vol. XII, No.2, June 2018, pp. 42-47.</p>
<p>• Published a paper titled “On Expounding the Employee-Oriented Policies of Southwest Airlines with reference to the UDAN Scheme ”, in the International Journal of Management studies, Statistics and Applied Economics, (ISSN: 2250-0367), Vol.7, No. II (December 2017), pp.01-16.</p>
<p>• Published an article titled “Sri Krsna-A Synthesizer Par Excellence”, in the book: CETANA, Vol. 2, Issue.1, published by the Department of Sanskrit and Indian Culture, SCSVMV University, August 2017.</p>
<p>• Published a paper titled “On Understanding Rasa in the Tradition of Advaita Vedanta”, in the International Journal of Humanities and Social Sciences, ISSN: 2250-3226, Vol.7, Number 1(2017), pp.1-5.</p>
<p>• Published a paper titled”The Ethical Structure of Economics: Revisited”, in the International Journal of Management studies, Statistics and Applied Economics, (ISSN: 2250-0367), Vol.6, No.1, June 2016, pp.01-16.</p>
<p>• Published a paper titled “The Philosophical Base of Advaita Vedanta and its Relevance to present-day Students”, in the International Journal of Current Research and Academic Review, (ISSN: 2347-3215), Vol.4, Number 4, April 2016, pp.74-79.</p>
<p>• Published an article titled “On Understanding the Implications of the Dictum: Thou Art That”, in the book: CETANA, Vol. 1, Issue.1, published by the Department of Sanskrit and Indian Culture, SCSVMV University, November 2015.</p>
<p>• Published a paper titled”Economic Maximization: Is It Feasible?”, in the International Journal of Management Studies, Statistics and Applied Economics,(ISSN: 2250-0367), Vol. 5, No.1, June 2015, pp.01-12.</p>
<p>• Published an article titled : “HR Planning in Educational Institutions”, in HRD Times (ISSN: 0976 – 7401), Vol.15, September 2013, pp.17-18.</p>
<p>• Published an article titled : “ A Synthesized Ethical Structure of Economics for the Emerging New World Economic Order” in the book : Prospects and Policy Challenges of India in the Recession Period,(ISBN:978-93-80713-00-7)Edited by Dr.J.Govindadass and Dr.S.Janakiraman, K.B. Publications, Ammoor, June 2013, pp. 188-194.</p>
<p>• Published an article titled: “ Taxation and Vicious Circle of Poverty”, in SELP Journal of Social Science (ISSN No: 0975-9999), Special Issue, Volume-IV, Issue-16, April-2013, pp.157-159.</p>
<p>• Published an article titled : “On Supply Chain Management” in Research Explorer(ISSN :2250-1940), Vol.2(3), February 2013, pp.1207-1209.</p>
<p>• Published an article titled : “ Supply Chain Management”, in HRD Times (ISSN: 0976 – 7401), Vol.15, No.2, February 2013, pp.24-25.</p>
<p>• Published an article titled : “Management Science and Economic Theory”, in HRD Times (ISSN: 0976 – 7401), Vol.14, No.7, July 2012, pp.14-15.</p>
<p>• Published a Paper titled : “On Education Management”, in the Indian Journal of Psychometry and Education, (ISSN:0378-1003) Vol, 43(2), July 2012, pp.208-11</p>
<p>• Published a paper titled: “Economic Maximization: Is It Desirable?”, in the International Journal of Management Studies and Applied Economics, (ISSN : 2250 – 0367), Vol.2, No.1, June 2012, pp. 85-93</p>
<p>• Published a paper titled “ On the Ethical Philosophy of Economics”, in the Indian Journal of Psychometry and Education, (ISSN:0378-1003) Vol, 42(1), January 2011, pp.97-99.</p>
<p>• Published a paper titled “On the Role of Cognitive Psychology in Economics”, in the Paraachi Journal of Psycho-Cultural Dimensions, (ISBN : 0971 – 7064) Vol.23(1) April 2007, pp.29-32.</p>
<p>• Published a paper titled: “On the Non – Maximization Factors Effecting Consumer Behaviour”, in the proceedings of the International Conference on “Marketing in the Age of Convergence”, organized by the Indian Institute of Management Kozhikode (IIMK) , 7-8 January 2006, pp.355-358.</p>
<p>• Published an article titled “Swami Vivekananda’s Ethical Perception of Vedantic Oneness”, in the Vedanta Kesari (ISSN : 0042-2983) Vol. 87, September 2000, pp.358-361.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2274" class="elementor-tab-title" data-tab="4" role="button" aria-controls="elementor-tab-content-2274" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">OTHERS</a>
					</div>
					<div id="elementor-tab-content-2274" class="elementor-tab-content elementor-clearfix" data-tab="4" role="region" aria-labelledby="elementor-tab-title-2274"><p>• UGC Orientation Course attended: 01<br />• UGC Refresher Course attended: 01<br />• Workshops/FDPs/Training Programmes/ Seminars/Conferences/Lectures attended: 25</p></div>
				</div>
								</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				</div>
		</div><p>The post <a href="https://kanchiuniv.ac.in/team/dr-k-s-sivakumar/">Dr.K.S.SIVAKUMAR</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></content:encoded>
					
		
		
			</item>
		<item>
		<title>Dr.D.Nageswara Rao</title>
		<link>https://kanchiuniv.ac.in/team/dr-d-nageswara-rao/?utm_source=rss&#038;utm_medium=rss&#038;utm_campaign=dr-d-nageswara-rao</link>
		
		<dc:creator><![CDATA[Admin]]></dc:creator>
		<pubDate>Tue, 30 Mar 2021 06:51:39 +0000</pubDate>
				<category><![CDATA[Sanskrit]]></category>
		<category><![CDATA[Team]]></category>
		<guid isPermaLink="false">https://kanchiuniv.ac.in/?p=3817</guid>

					<description><![CDATA[<p>Assistant Professor</p>
<p>The post <a href="https://kanchiuniv.ac.in/team/dr-d-nageswara-rao/">Dr.D.Nageswara Rao</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></description>
										<content:encoded><![CDATA[<div class="wprt-container">		<div data-elementor-type="wp-post" data-elementor-id="3817" class="elementor elementor-3817" data-elementor-post-type="post">
						<section class="elementor-section elementor-top-section elementor-element elementor-element-14b9451 elementor-section-height-min-height elementor-section-items-bottom elementor-section-content-bottom elementor-section-boxed elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="14b9451" data-element_type="section" data-e-type="section" data-settings="{&quot;background_background&quot;:&quot;classic&quot;}">
							<div class="elementor-background-overlay"></div>
							<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-16e8e23" data-id="16e8e23" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-bf03cb7 elementor-widget elementor-widget-heading" data-id="bf03cb7" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">Dr.D.Nageswara
Rao</h2>				</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-6ef17eb elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="6ef17eb" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-9c7d532" data-id="9c7d532" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-ec01236 elementor-widget elementor-widget-spacer" data-id="ec01236" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-16b3618 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="16b3618" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-7de353b" data-id="7de353b" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<section class="elementor-section elementor-inner-section elementor-element elementor-element-0e6f2e8 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="0e6f2e8" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-b83c8dd" data-id="b83c8dd" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-2586a5c elementor-widget elementor-widget-image" data-id="2586a5c" data-element_type="widget" data-e-type="widget" data-widget_type="image.default">
				<div class="elementor-widget-container">
															<img fetchpriority="high" decoding="async" width="283" height="354" src="https://kanchiuniv.ac.in/wp-content/uploads/2021/03/Nageswara-Rao.jpg" class="attachment-large size-large wp-image-3819" alt="" srcset="https://kanchiuniv.ac.in/wp-content/uploads/2021/03/Nageswara-Rao.jpg 283w, https://kanchiuniv.ac.in/wp-content/uploads/2021/03/Nageswara-Rao-240x300.jpg 240w" sizes="(max-width: 283px) 100vw, 283px" />															</div>
				</div>
					</div>
		</div>
				<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-e04eb97" data-id="e04eb97" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-37ac925 elementor-widget elementor-widget-heading" data-id="37ac925" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">Dr.D.Nageswara
Rao</h2>				</div>
				</div>
				<div class="elementor-element elementor-element-3bc6485 elementor-widget elementor-widget-text-editor" data-id="3bc6485" data-element_type="widget" data-e-type="widget" data-widget_type="text-editor.default">
				<div class="elementor-widget-container">
									<p>Assistant Professor<br /><em style="font-size: 15px;">Contact : 044 27264301, 252<br /></em><span style="font-size: 15px;"><br /></span></p>								</div>
				</div>
					</div>
		</div>
					</div>
		</section>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-a799d8b elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="a799d8b" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-87b58a1" data-id="87b58a1" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-d3e8b25 elementor-widget elementor-widget-spacer" data-id="d3e8b25" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				</div>
		</div><p>The post <a href="https://kanchiuniv.ac.in/team/dr-d-nageswara-rao/">Dr.D.Nageswara Rao</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></content:encoded>
					
		
		
			</item>
		<item>
		<title>Dr.Sujatha Ragavan​​</title>
		<link>https://kanchiuniv.ac.in/team/dr-sujatha-ragavan%e2%80%8b%e2%80%8b/?utm_source=rss&#038;utm_medium=rss&#038;utm_campaign=dr-sujatha-ragavan%25e2%2580%258b%25e2%2580%258b</link>
		
		<dc:creator><![CDATA[Admin]]></dc:creator>
		<pubDate>Tue, 01 Dec 2020 04:50:54 +0000</pubDate>
				<category><![CDATA[Sanskrit]]></category>
		<category><![CDATA[Team]]></category>
		<guid isPermaLink="false">https://kanchiuniv.ac.in/?p=2028</guid>

					<description><![CDATA[<p>Assistant Professor</p>
<p>The post <a href="https://kanchiuniv.ac.in/team/dr-sujatha-ragavan%e2%80%8b%e2%80%8b/">Dr.Sujatha Ragavan​​</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></description>
										<content:encoded><![CDATA[<div class="wprt-container">		<div data-elementor-type="wp-post" data-elementor-id="2028" class="elementor elementor-2028" data-elementor-post-type="post">
						<section class="elementor-section elementor-top-section elementor-element elementor-element-14b9451 elementor-section-height-min-height elementor-section-items-bottom elementor-section-content-bottom elementor-section-boxed elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="14b9451" data-element_type="section" data-e-type="section" data-settings="{&quot;background_background&quot;:&quot;classic&quot;}">
							<div class="elementor-background-overlay"></div>
							<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-16e8e23" data-id="16e8e23" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-bf03cb7 elementor-widget elementor-widget-heading" data-id="bf03cb7" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">Dr.Sujatha Ragavan</h2>				</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-6ef17eb elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="6ef17eb" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-9c7d532" data-id="9c7d532" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-ec01236 elementor-widget elementor-widget-spacer" data-id="ec01236" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-16b3618 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="16b3618" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-7de353b" data-id="7de353b" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<section class="elementor-section elementor-inner-section elementor-element elementor-element-0e6f2e8 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="0e6f2e8" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-b83c8dd" data-id="b83c8dd" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-2586a5c elementor-widget elementor-widget-image" data-id="2586a5c" data-element_type="widget" data-e-type="widget" data-widget_type="image.default">
				<div class="elementor-widget-container">
															<img decoding="async" width="817" height="1024" src="https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-817x1024.jpg" class="attachment-large size-large wp-image-2029" alt="" srcset="https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-817x1024.jpg 817w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-239x300.jpg 239w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-768x963.jpg 768w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-1225x1536.jpg 1225w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo-350x439.jpg 350w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/sujata-photo.jpg 1460w" sizes="(max-width: 817px) 100vw, 817px" />															</div>
				</div>
					</div>
		</div>
				<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-e04eb97" data-id="e04eb97" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-37ac925 elementor-widget elementor-widget-heading" data-id="37ac925" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">Dr.Sujatha Ragavan</h2>				</div>
				</div>
				<div class="elementor-element elementor-element-3bc6485 elementor-widget elementor-widget-text-editor" data-id="3bc6485" data-element_type="widget" data-e-type="widget" data-widget_type="text-editor.default">
				<div class="elementor-widget-container">
									<p>Assistant Professor<br /><em style="font-size: 15px;">Contact : 044 27264301, 252<br /></em><span style="font-size: 15px;"><br /></span></p>								</div>
				</div>
					</div>
		</div>
					</div>
		</section>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-d729146 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="d729146" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-aa3b6dc" data-id="aa3b6dc" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-e5e4d37 elementor-widget elementor-widget-accordion" data-id="e5e4d37" data-element_type="widget" data-e-type="widget" data-widget_type="accordion.default">
				<div class="elementor-widget-container">
							<div class="elementor-accordion">
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2411" class="elementor-tab-title" data-tab="1" role="button" aria-controls="elementor-tab-content-2411" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PROFILE</a>
					</div>
					<div id="elementor-tab-content-2411" class="elementor-tab-content elementor-clearfix" data-tab="1" role="region" aria-labelledby="elementor-tab-title-2411"><p>B.Com.,M.A.(Vaishnavism),M.A.(Sanskrit), B.Ed., BLIS, Ph.D.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2412" class="elementor-tab-title" data-tab="2" role="button" aria-controls="elementor-tab-content-2412" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">TEACHING</a>
					</div>
					<div id="elementor-tab-content-2412" class="elementor-tab-content elementor-clearfix" data-tab="2" role="region" aria-labelledby="elementor-tab-title-2412"><p>Sahitya<br />Indian Culture<br />General Sanskrit</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2413" class="elementor-tab-title" data-tab="3" role="button" aria-controls="elementor-tab-content-2413" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PUBLICATIONS</a>
					</div>
					<div id="elementor-tab-content-2413" class="elementor-tab-content elementor-clearfix" data-tab="3" role="region" aria-labelledby="elementor-tab-title-2413"><h4>Conferences</h4><p><b>1)</b> Attended and presented a Paper in International Conference in Mahabharata conducted by Kanchi Kamakoti Mutt on Dec 2003.<br /><b>2)</b> Attended and presented a Paper in National seminar in Researches creative techniques in class room teaching conducted by NES National centre for R &amp; D in Education, Science and Technology on Dec 2003.<br /><b>3)</b> Attended and presented a Paper on 22nd to 24th Aug 2004, in 20th International Ramayana Conference – Tirupathy<br /><b>4)</b> Attended a workshop in Preservative conservation of Manuscripts organized by National mission for Manuscripts New Delhi at Government Museum, Chennai on 2007.<br /><b>5)</b> Attended and presented a Paper in National seminar The influence of Sanskrit upon contemporary languages at Yogi Ram Surat Kumar Ashram 2009 during March 2009.<br /><b>6)</b> Attended and presented a Paper in National seminar on moral values in classical Sanskrit literature and their relevance to present society.<br /><b>7)</b> Attended and presented a paper in the National Seminar organized by Dept. Of Sanskrit and Indian Culture, SCSVMV Deemed University, Kanchipuram, Tamil Nadu. On Pramanas during 23rd-24th February 2012.<br /><b>8)</b> Attended and presented the paper in the national seminar on the relationship between Tamil and Sanskrit languages at Raja’s college at thiruvaiyaru from 23.03.2012 to 25.03.2012.<br /><b>9)</b> Attended the workshop in comparative workshop on classical Tamil and Sanskrit organized by Dept.of Sanskrit at Raja’s college at Thirvaiyaru from 14-12-2012 to 23-12-2012.<br /><b>10)</b> Attended the workshop in Bhatta Rahasyam of Khandadeva organized by SCSVMV Deemed University Enathur Kanchipuram from Feburary 12th to 14th, 2013.<br /><b>11)</b> Attended the All India Sanskrit Women Scholars Conference on Empowerment of Womenin Sanskrit Literature at Rashriya Samskrita Vidyapeetha Tirupati on March 07th and 08th 2013.<br /><b>12)</b> Attended the UGC National Seminar on Gender Based Violence against women Challenges and strategies at Sri Padmavathi Mahila Viswavidyalayam, Tirupati on 25th and 26th march. 2013.<br /><b>13)</b> Attended an International Seminar on Mahabharata organized by Sri Vadiraja Research Foundation, Geeta Mandir 2nd Floor, Udupi, and Karnataka, held on17th May to19thMay 2013. Topic: Dharamartha Chinthanam in Mahabharata.<br /><b>14)</b> Attended three days International Conference in Sanskrit languages organized by Delhi Sanskrit Academy, New delhi held on 23rd to 25th August 2013. Topic: Manavagivane ashtanga yogasya mahatvam.<br /><b>15)</b> Attended the the conference on the epoch of Vivekananda in modern India conference at Rashriya Samskrita VidyapeethaTirupati on 23rd and 24th December2013.</p><h4>Journals</h4><p><b>1)</b> Science in Ancient times-VastuSastra in Vision of Science (a science magazine) by SCSVMV on 2013<br /><b>2)</b> PeriyalwarpadiyaRamayanam &#8211; in periyalwarayuv malar-alwargalvizha 11-6-2014 by ArulmiguRanganathatrswamyThirukoil, Srirangam.<br /><b>3)</b> AbhijanaSakuntalesamajikasthidiyaha in VijnanaJhari Research Journal Volume II by SCSVMV University on 2014<br /><b>4)</b> Ratnavalyamalankaralakshanani in jigyasa an interdisciplinary referred research journal (ISSN0974-7648) in volume VII, June 2014.<br /><b>5)</b> Megadooteuttaraamdishimpradishtite inSamskritasri published on September 2014.<br /><b>6)</b> An insight of vishnusharma’spanchatantra in Vaichariki A Multidisciplinary Referred International Research Journal(ISSN 2249-8907) in Volume IV issue 3 September 2014.<br /><b>7)</b> KiratharjunapradamadhivitiyasargataArthantaranyasalankaraParichayaha in ShodhPravak A Multidisciplinary Referred International Research Journal(ISSN 2231-413X) in Volume IV issue 4 October 2014<br /><b>8)</b> Alakayamyakshabhavanamaalokatesma in Samskritasri published on October 2014.<br /><b>9)</b> YakshasyaSandesamSravayatiMedaha inSamskritasri published on November 2014.<br /><b>10)</b> Samskritasyamahatvam in Perarulalan (ISSN No 2350-0662) published on November 2014.<br /><b>11)</b> Ratnavalyamangahatatsartakatvamcha in Samskritasri published on December 2014.<br /><b>12)</b> YathirajaMahatmayam in Perarulalan (ISSN No 2350-0662) published on December 2014<br /><b>13)</b> Gitagovindakavyasyasamanyaparichayam published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during January – 2015.<br /><b>14)</b> The divinity of water in Vision of science (a science magazine) 2015 National science day, SCSVMV University.<br /><b>15)</b> VenisamhareAlankaraparichayaha in Shodha-prajna (ISSN No 2347-9892) published by Half-yearly research journal of Uttatkhand University on January 2015.<br /><b>16)</b> Brahmilipi -EkamAdyanam in Samskritasri published on January2015.<br /><b>17)</b> The source of Yathiraja’s philosophy in Perarulalan (ISSN No 2350-0662) published on February 2015.<br /><b>18)</b> Yathiraja’s religious teaching in Perarulalan (ISSN No 2350-0662) published on March 2015.<br /><b>19)</b> Raivataparvatavarnayadimagaha in Samskritasri published on July 2015.<br /><b>20)</b> Raivataparvatavarnayadimagaha in Samskritasri published on August 2015.<br /><b>21)</b> Cosmology of Yathiraja in Perarulalan (ISSN No 2350-0662) published on September 2015<br /><b>22)</b> Ethics in Ramanujas philosophy in Perarulalan (ISSN No 2350-0662) published on October 2015.<br /><b>23)</b> Ontological categories of Yathirajas philosophy in Perarulalan (ISSN No 2350-0662) published on December 2015.<br /><b>24)</b> The nature of God in Perarulalan (ISSN No 2350-0662) published on January2016.<br /><b>25)</b> Naisadiyacaritepanchanalivarnanam in Chetana on 1st March 2016.<br /><b>26)</b> Revelence of PanchaMahaYajna for a healthy Society in Shrutishoba Volume 3, issue 3, (ISSN 2348-1102) published in April 2016.<br /><b>27)</b> Principles of righteous living in Mahabharata in Ethical values as revealed in Dravidian language (ISBN 978-93-81992-40-1) on June 2016.<br /><b>28)</b> Remedial measures to overcome the challenges in teaching Sanskrit in International multilingual conference (ISBN- 978-81-930475-9-0) on September 2016<br /><b>29)</b> Comparative study of Sanskrit and English in Roots international journal for Multidisciplinary research (ISSN 2349-8684) on October 2016.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2414" class="elementor-tab-title" data-tab="4" role="button" aria-controls="elementor-tab-content-2414" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">OTHERS</a>
					</div>
					<div id="elementor-tab-content-2414" class="elementor-tab-content elementor-clearfix" data-tab="4" role="region" aria-labelledby="elementor-tab-title-2414"><h4>FDPs, Seminars, Workshops</h4><p><b>1)</b> Attended and presented a Paper in International Conference in “Mahabharata” conducted by KanchiKamakoti Mutt on Dec 2003.<br /><b>2)</b> Attended and presented a Paper in National seminar in “Researches creative techniques in class room teaching” conducted by NES National center for R &amp; D in Education, Science and Technology on Dec 2003.<br /><b>3)</b> Attended and presented a Paper on 22ndto 24thAug 2004, in 20th “International Ramayana Conference” – Tirupathi<br /><b>4)</b> Attended a workshop in “Preservative conservation of Manuscripts” organized by National mission for Manuscripts New Delhi at Government Museum, Chennai on 2007,<br /><b>5)</b> Attended and presented a Paper in National seminar “The influence of Sanskrit uponcontemporary languages” at Yogi Ram Surat Kumar Ashram 2009 during March 2009.<br /><b>6)</b> Attended and presented a Paper in National seminar on “moral values in classical Sanskrit literature and their relevance to present society” in VenkatreswaraUnoversityTirupaty on 29th&amp; 30thof December 2011.<br /><b>7)</b> Attended and presented a paper in the National Seminar on “Pramanas” organized by Dept. of Sanskrit and Indian Culture, SCSVMV University, Kanchipuram, Tamil Nadu during 23rd&amp;24thFebruary, 2012.<br /><b>8)</b> Attended and presented the paper in the national seminar on “The relationship between Tamil and Sanskrit languages” at Raja’s college at thiruvaiyaru from 23.03.2012 to 25.03.2012.<br /><b>9)</b> Attended the workshop in comparative workshop on “Classical Tamil and Sanskrit” organized by Dept.of Sanskrit at Raja’s college at Thirvaiyaru from 14-12-2012 to 23-12-2012<br /><b>10)</b> Attended the workshop in “BhattaRahasyam of Khandadeva” organized by SCSVMV University Enathur, Kanchipuram from February 12thto 14th, 2013.<br /><b>11)</b> Attended the All India Sanskrit Women Scholars Conference on Empowerment of Women in Sanskrit Literature at RashriyaSamskritaVidyapeethaTirupati on March 07thand 08th2013. Topic: Empowerment of Women in Mahabharata<br /><b>12)</b> Attended the UGC National Seminar on Gender Based Violence against women Challenges and strategies at Sri PadmavathiMahilaViswavidyalayam, Tirupati on 25thand 26thmarch. 2013. Topic: Human Rights violation and violence against women<br /><b>13)</b> Attended an International Seminar on Mahabharata organized by Sri Vadiraja Research Foundation, GeetaMandir 2nd Floor, Udupi, and Karnataka, held on17thMay to19thMay 2013. Topic: DharamarthaChinthanam in Mahabharata .<br /><b>14)</b> Attended three days International Conference in Sanskrit languages organized by Delhi Sanskrit Academy, New Delhi held on 23rdto 25thAugust 2013.Topic: Manavagivaneashtangayogasyamahatvam.<br /><b>15)</b> Attended the conference on the ‘Epoch of Vivekananda in modern India’ conference at RashriyaSamskritaVidyapeetha, Tirupati on 23rdand 24thDecember, 2013. Topic: Vedanta of Sri Ramakrishna and Swami Vivekananda.<br /><b>16)</b> Attended ICPR Sponsored Periodical Lecture Series Programme on “Evolution on Vedanta thought”organised by Department of Sanskrit, Sri ChandrasekharendraSaraswathiViswaMahavidyalaya (SCSVMV University) Kanchipuram, on 12thFebruary 2014.<br /><b>17)</b> Attended the national seminar on Rasa theory in SCSVMV at Kanchipuramm from 27thand 28thMarch 2014.Topic. Rasa Nirupanam.<br /><b>18)</b> Attended the International seminar on Karnataka State University at Bangalore 15th&amp; 16thSeptember 2014. Topic: Women Education in India<br /><b>19)</b> Attended and presented a paper in National Seminar on “Relevance of Upanisads in Modern Days “Organized by Department of Sanskrit, S.B.Arts and K.C.P. Science College, Bijapur on 6th-7thSeptember 2014. Topic- Relevance of Upanishads for Education System.<br /><b>20)</b> Attended and presented a paper in National Seminar on &#8220;SwamiVivekananda: The Voice of the Youth&#8221; Organized by Department of English, S.B.Arts and K.C.P. Science College, Bijapur on 6th-7thSeptember 2014. Topic- Vivekananda views on women.<br /><b>21)</b> Attended and presented a paper in National Seminar on Historicity of Ramayana organized by BharatiyaIhitasaSangalanaSamiti, Andhra Pradesh, on 8thand 9thNovember 2014. Topic- Rishis in Ramayana.<br /><b>22)</b> Attended orientation and Exchange Programme on Writing and Publishing Research Articles, Jointly organised by the Faculty of Management Studies, SriChandrasekharendraSaraswathiViswaMahavidyalaya (SCSVMV University) Kanchipuram and TKM Institute of Management, Kollam on 30th November 2014. <b>23)</b> Attended and presented a paper in UGC Sponsored National Seminar on “Moral Values Depicted in Sanskrit literature” organized by Dept. of Sanskrit, Poornaprajna College and Mangalore University Sanskrit Teachers’ Association, Udupi, Karnataka,on 19th-20thDecember, 2014. Topic- control of senses in viduraniti<br /><b>24)</b> Attended as an observer in National Seminar on “Shastric and Prayogic Elements of Agamas” Jointly organized by Dept. of Sanskrit &amp; Indian Culture SCSVMV and Indira Gandhi National Centre for the Arts, New Delhi on 7th-8th January, 2015.<br /><b>25)</b> Attended and presented a paper in International Seminar on “Ayurveda-Yoga-Vedanta international conference Jan,2015” organized by Dept. of AYUSH, Department of Karnataka&amp; Karnataka State University, Bangalore, Yoga ParijnanaPratishthana(R)and PoornayuAyurveda College,Bangalore,on 10th-11thJanuary, 2015. Topic- Yogic culture of the body and mind.<br /><b>26)</b> Participated in oneday Seminar organized by Internal Quality Assurance Cell, SCSVMV University, Kanchipuram held on the 30thday of January 2015, SCSVMV University, Kanchipuram. Topic: Enhancement of Quality at University Level.<br /><b>27)</b> Attended and presented a paper in International Conference onVedic sciences”organized by AarshadaraVedavijjnasammelanam, Mythic society, Bengaluru on 1stFebruary, 2015. Topic: Pancharatra Agama.<br /><b>28)</b> Attended Faculty Development Programme on Classroom to Boardroom, Organized by the Dept. of Information Technology, Sri ChandrasekharendraSaraswathiViswaMahavidyalaya (SCSVMV University) Kanchipuram, on 20thFebruary 2015.<br /><b>29)</b> Attended and presented a paper in International Conference on “Relevance of Yanja for a Healthy Society” organized by Veda VijnanaShodhaSamsthanam,Chennenahalli, Bengaluru on 28thFebruary &#8211; 2ndMarch 2015. Topic- Relevence of Panchamahayajna for healthy society.<br /><b>30)</b> Attended and presented a paper in National Seminar on “Women in Sanskrit Literature” organized by Dept. of Sanskrit, Queen Marry’sAutonomus College, Chennai on 3rdMarch 2015. Topic- Position of Women in Kalidasian Dramas<br /><b>31)</b> Attended User Awareness Programme on Shodhaganga and Anti-Plagiarism Software (iThenticate/Turnitin), organised by SCSVMV University Library, Kanchipuram, on 26thMarch 2015.<br /><b>32)</b> Attended and presented a paper in National Samskrita Seminar Organized by SamskritaBharati at Meenakshi College Kodambakkam Chennai on 11thto 13thSeptember 2015. Topic- SamskritaBhasaVaishityam.<br /><b>33)</b> Attend and presented a paper in National Conference On Feminism organized by K.C.S. KasiNadar College of Arts &amp; Science, Chennai on 06.10.15. Topic: Feminism in Sanskrit Literature<br /><b>34)</b> Attended and presented a paper in International Seminaron “Vedic Science Organized by Vedic University Tirupaty on 18thto 21stNovember 2015. Topic- Vedic Medicine.<br /><b>35)</b> Attended one day National Workshop at SCSVMV University on 18thFebruary 2016. Topic : Effective teaching &amp; learning Methodology.<br /><b>36)</b> Attended the special Lecture Series at SCSVMV University on 25thFeb 2016. Topic :Infuence of Yoga Sastra on NyayaManjari of NyayaBhusanam.<br /><b>37)</b> Attended the National Seminar level seminar at SCSVMV University on 26.02.2016. Topic : National level seminar on Research Techniques<br /><b>38)</b> Attended and present a paper on two day National seminar on SrimadValmiki Ramayana Dharmimasa at Madras Sanskrit College on 27th&amp; 28thFeb 2016. Topic: RamapaalitaBhratruDarmaha<br /><b>39)</b> Attended and paper present a paper on two day National seminar on continuing creative efforts for the sustenance of Sanskrit at SCSVMV University on 3rd&amp; 4thMarch 2016. Topic : TiruputkuzhiSrikrishnaTatayaryaMahadesika<br /><b>40)</b> Attended and paper present a paper on two day National seminar on Glory of Venkateswara in the Puranas at Sri Venkateswara University Tirupaty on 28th&amp; 29thMarch 2016. Topic : Sri Venkateswara’s prayer by Brahma Deva to Narada.<br /><b>41)</b> Attended two day National Workshop at SCSVMV University on 19th&amp; 20thApril 2016. Topic :Vrittivimarsah.<br /><b>42)</b> Attended and paper present a paper on One day International Conference on Ethical Values revealed in Dravidiam Language Orgainsed by ElagiriMuthamilMandram&amp; the Dept. of Tamil, Sri Venkateswara University, Tirupaty at ElagiriHills, Vellore Dt, Tamilnadu on 25thJune 2016. Topic : Principles of Righteous living in Mahabharata.<br /><b>43)</b> Attended one day National Conference on Bibilotherphy and Webtherapy organized by Central Library SCSVMV University in association with Madras Library Association Chennai on 11thJune 2016.<br /><b>44)</b> Act as a co-coordinator fort Azadi 70 conducted on 18th&amp; 19thof August in2016.<br /><b>45)</b> Attended and presented a paper in International Conference on 31.08.2016 at Department of English SCSVMV University. Topic:Classroom practices in language games.<br /><b>46)</b> Attended and presented a paper in International multilingual Conference on 7th&amp; 8that EhtirajCollege for women Chennai. Topic: Remedial measures to overcome the challenges in teaching Sanskrit.<br /><b>47)</b> Attended and presented a paper in National Seminar on 16th&amp; 17thSeptember.2016 at Kuppuswami Research Institute. Topic: VedantadesikanumPadukasahasramum.<br /><b>48)</b> Attended and presented a paper in National Conference on 21st &amp; 22nd September. 2016 at Sri RamanujaMillinnium Celebration at Venkateswara University Tirupaty. Topic: Ramanuja’sPhiilosophy on Moksha.<br /><b>49)</b> Attended and presented a paper in International Conference on 7thOctober, 2016 at Government Arts &amp; Science College for women Bargur, Tamilnadu. Topic: Comparative study of Sanskrit and English.<br /><b>50)</b> Attended and presented a paper in International Conference on 11th-12thJanuary 2017 at Tamilnadu Hindi Sahitya Academy, Chennai.Topic: Sanskrit and rastriyachetana.<br /><b>51)</b> Attended and presented a paper in National Seminar on 30th- 31stJanuary 2017 at Sri Venkateswara Vedic University, Tirupati. Topic: Sivagameshivapooja.<br /><b>52)</b> Attended and presented a paper in National Seminar on 4th- 5thFebruary 2017 at Madras Sanskrit College, Mylaopre, Chennai. Topic: RajanusheyaDharmopadeshaha.<br /><b>53)</b> Attended and presented a paper in National Seminar on 6th- 7thFebuary 2017 at Sri Venkateswaraoriental degree&amp; P.G. College Tirupati. Topic:VaishnavaSampradayemanavajeevanasya Bhakti yogaha.<br /><b>54)</b> Attended and presented a paper in National Seminar on 22nd-23rd February, 2017 at Sri Venkateswara University, Tirupati. Topic: Samskritavagmayeeparyavaranavigjanam.</p><h4>Refresher Courses</h4><p><b>1)</b> Completed the first refresher course and presented a paper on “Nalayiradhiyaprabanda pranitha alwaracharyanam parichyaha” in 05.11.2004 to 25.11.2004.<br /><b>2)</b> Completed the second refresher course and presented a paper on “Dharmaha jagatha prathishta” held on 15.12.2005 to 04.01.2006.</p></div>
				</div>
								</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-a799d8b elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="a799d8b" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-87b58a1" data-id="87b58a1" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-d3e8b25 elementor-widget elementor-widget-spacer" data-id="d3e8b25" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				</div>
		</div><p>The post <a href="https://kanchiuniv.ac.in/team/dr-sujatha-ragavan%e2%80%8b%e2%80%8b/">Dr.Sujatha Ragavan​​</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></content:encoded>
					
		
		
			</item>
		<item>
		<title>Dr.Debajyoti Jena</title>
		<link>https://kanchiuniv.ac.in/team/dr-debajyoti-jena/?utm_source=rss&#038;utm_medium=rss&#038;utm_campaign=dr-debajyoti-jena</link>
		
		<dc:creator><![CDATA[Admin]]></dc:creator>
		<pubDate>Tue, 01 Dec 2020 04:26:42 +0000</pubDate>
				<category><![CDATA[Sanskrit]]></category>
		<category><![CDATA[Team]]></category>
		<guid isPermaLink="false">https://kanchiuniv.ac.in/?p=2016</guid>

					<description><![CDATA[<p>Assistant Professor</p>
<p>The post <a href="https://kanchiuniv.ac.in/team/dr-debajyoti-jena/">Dr.Debajyoti Jena</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></description>
										<content:encoded><![CDATA[<div class="wprt-container">		<div data-elementor-type="wp-post" data-elementor-id="2016" class="elementor elementor-2016" data-elementor-post-type="post">
						<section class="elementor-section elementor-top-section elementor-element elementor-element-14b9451 elementor-section-height-min-height elementor-section-items-bottom elementor-section-content-bottom elementor-section-boxed elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="14b9451" data-element_type="section" data-e-type="section" data-settings="{&quot;background_background&quot;:&quot;classic&quot;}">
							<div class="elementor-background-overlay"></div>
							<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-16e8e23" data-id="16e8e23" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-bf03cb7 elementor-widget elementor-widget-heading" data-id="bf03cb7" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">DR.DEBAJOTHI JENA</h2>				</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-6ef17eb elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="6ef17eb" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-9c7d532" data-id="9c7d532" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-ec01236 elementor-widget elementor-widget-spacer" data-id="ec01236" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-16b3618 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="16b3618" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-7de353b" data-id="7de353b" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<section class="elementor-section elementor-inner-section elementor-element elementor-element-0e6f2e8 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="0e6f2e8" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-b83c8dd" data-id="b83c8dd" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-2586a5c elementor-widget elementor-widget-image" data-id="2586a5c" data-element_type="widget" data-e-type="widget" data-widget_type="image.default">
				<div class="elementor-widget-container">
															<img loading="lazy" decoding="async" width="759" height="988" src="https://kanchiuniv.ac.in/wp-content/uploads/2020/12/5.jpg" class="attachment-large size-large wp-image-2018" alt="" srcset="https://kanchiuniv.ac.in/wp-content/uploads/2020/12/5.jpg 759w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/5-230x300.jpg 230w, https://kanchiuniv.ac.in/wp-content/uploads/2020/12/5-350x456.jpg 350w" sizes="(max-width: 759px) 100vw, 759px" />															</div>
				</div>
					</div>
		</div>
				<div class="elementor-column elementor-col-50 elementor-inner-column elementor-element elementor-element-e04eb97" data-id="e04eb97" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-37ac925 elementor-widget elementor-widget-heading" data-id="37ac925" data-element_type="widget" data-e-type="widget" data-widget_type="heading.default">
				<div class="elementor-widget-container">
					<h2 class="elementor-heading-title elementor-size-default">DR.DEBAJOTHI JENA</h2>				</div>
				</div>
				<div class="elementor-element elementor-element-3bc6485 elementor-widget elementor-widget-text-editor" data-id="3bc6485" data-element_type="widget" data-e-type="widget" data-widget_type="text-editor.default">
				<div class="elementor-widget-container">
									<p>Assistant Professor <br /><em style="font-size: 15px;">Contact : 044 27264301, 252<br /></em><span style="font-size: 15px;">E-Mail:<em><a href="mailto:drdebajyotijena@gmail.com">drdebajyotijena@gmail.com</a></em></span></p>								</div>
				</div>
					</div>
		</div>
					</div>
		</section>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-d729146 elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="d729146" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-aa3b6dc" data-id="aa3b6dc" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-e5e4d37 elementor-widget elementor-widget-accordion" data-id="e5e4d37" data-element_type="widget" data-e-type="widget" data-widget_type="accordion.default">
				<div class="elementor-widget-container">
							<div class="elementor-accordion">
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2411" class="elementor-tab-title" data-tab="1" role="button" aria-controls="elementor-tab-content-2411" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PROFILE</a>
					</div>
					<div id="elementor-tab-content-2411" class="elementor-tab-content elementor-clearfix" data-tab="1" role="region" aria-labelledby="elementor-tab-title-2411"><p>M.A, B.Ed, M.phil, Ph.D</p><p>His Area of Interest lies in Sahitya, Kalidasian Drama &amp; Dramaturgy, Research Methodology, Manuscriptology, Linguistics &amp; Literature domains.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2412" class="elementor-tab-title" data-tab="2" role="button" aria-controls="elementor-tab-content-2412" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">RESPONSIBILITIES</a>
					</div>
					<div id="elementor-tab-content-2412" class="elementor-tab-content elementor-clearfix" data-tab="2" role="region" aria-labelledby="elementor-tab-title-2412"><h2>Administrative Responsibilities</h2><p><b>1)</b> Act as a Member of receiving Committee for Xth UGC Plan Committee during the visit to Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, in the year of 2002.<br /><b>2)</b> As a Team Leader, taking University Students to Jiwaji University, Gwaliar, for participating in AIU-Home Exchange Programme at Gwaliar on 07th- 14th Dec. 2004.<br /><b>3)</b> As a Coordinator, Organised All India Sanskrit Elocution Contest, Sponsored by RastriyaSamskritSamsthan, New Delhi at Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, on 24th -27th Dec. 2004.<br /><b>4)</b> As a Co-ordinator, Organised“Samskritotsva-2006” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya(SCSVMV University) Kanchipuram, on 2ndDec. 2006 .<br /><b>5)</b> As a Co-ordinator, Organised“Samskritotsva-2007” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya(SCSVMV University) Kanchipuram, on 13th Sept. 2007.<br /><b>6)</b> Act as a Member, Organized “Eleventh Convocation” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram on 2nd February 2008.<br /><b>7)</b> As an Examiner, attended workshop for setting the Question Paper at Tamilnadu Public Service Commission, Chennai, from 31st Aug 2009 to 02nd Sept 2009.<br /><b>8)</b> Act as a member for “Admission Committee &#8211; 2009” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2009.<br /><b>9)</b> Act as a Member of Hospitality Committee for UGC Review Committee during the visit to Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the year of 2009.<br /><b>10)</b> As a Coordinator, Organized “Samskritotsva-2009” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, on 22nd Jan. 2010.<br /><b>11)</b> Act as a Convener for Catering Committee of 13th Convocation of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, on 28th March 2010.<br /><b>12)</b> Act as a Member for “Admission Committee &#8211; 2010” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2010.<br /><b>13)</b> Act as a Member for “Anti-Ragging Committee &#8211; 2010” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2010.<br /><b>14)</b> Act as a Member for “Admission Committee &#8211; 2011” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2011.<br /><b>15)</b> Act as a Member for “Academic Council” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2011.<br /><b>16)</b> Act as a Member of Hospitality Committee for NAAC Peer Committee during the visit to Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, on 9th -11th January 2012.<br /><b>17)</b> Act as a Chairman for “University Valuation for Sanskrit &#8211; 2012” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2012.<br /><b>18)</b> Act as a Member for “Academic Council” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2012.<br /><b>19)</b> Act as a Member for “Admission Committee &#8211; 2012” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2012.<br /><b>20)</b> Act as an Additional Chief Superintendent for “University Theory Examination-2012” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2012.<br /><b>21)</b> As an Examiner, evaluated the Dissertation of M.Phil. Degree of Pondicherry University, Puducherry in the academic year 2012.<br /><b>22)</b> Act as Chief Superintendent for “Research Methodology Examination-2013” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2013.<br /><b>23)</b> As an Examiner and Question Setter for P.G. Degree of Dept. of Sanskrit , Pondicherry University,Puducherry during May 2013.<br /><b>24)</b> Act as a Member for Special Task Force of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2013.<br /><b>25)</b> Act as a Member for Disciplinary Committee of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2013.<br /><b>26)</b> Act as Chief Invigilator for “Group-IV Examination” of Tamilnadu Public Service Commission, Chennai, in Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram on 25th August 2013.<br /><b>27)</b> As a Guide taking Sanskrit Students to Rastriya Sanskrit Vidyapeetha, Tirupati for participating in ASSTF-2014 from 22nd- 25th Jan. 2014.<br /><b>28)</b> Act as a Chairman of Disciplinary Committee for Tarunyam &#8211; 2014” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, from 20th -21st March 2014.<br /><b>29)</b> As a Co-Coordinator, Organized National Seminar on “Rasa Theory” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, on 27th -28th March 2014.<br /><b>30)</b> Act as Chief Superintendent for “Research Methodology Examination-2014” of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, during the month of April 2014.<br /><b>31)</b> Act as a Member for Internal Quality Assurance Cell nominated by Vice Chancellor of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, in the academic year 2014.<br /><b>32)</b> Act as a Member of Disciplinary Committee for 18th Convocation &#8211; 2014 of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, from 18th -19th October 2014.<br /><b>33)</b> As an Examiner and Question Setter for P.G. Degree of Dept. of Sanskrit, Pondicherry University,Puducherry on 30th April 2015.<br /><b>34)</b> As an Examiner for the Project Viva Examination for P.G. Sanskrit, Dept. of Sanskrit, Pondicherry University, Puducherry on 30th April 2015.<br /><b>35)</b> Act as a Member for Internal Quality Assurance Cell nominated by Vice Chancellor of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, on 06th May 2015.<br /><b>36)</b> As a Co-ordinator, Organized “Samskritotsva-2015” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya(SCSVMV University) Kanchipuram, on 28thSeptember 2015.<br /><b>37)</b> Act as a Member of Hospitality Committee for 19th Convocation &#8211; 2015 of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya, (SCSVMV University) Kanchipuram, on 25th October 2015.<br /><b>38</b> As an Examiner and Question Setter for U.G &amp; P.G. Courses (Sanskrit), Rastriya Sanskrit Vidyapeetha, Tirupati, on 15th December 2015.<br /><b>39)</b> As a Co-ordinator, Organized National Seminar on “Continuing Creative efforts for the sustenance of Sanskrit” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya(SCSVMV University) Kanchipuram, on 4th -5thMarch 2016.<br /><b>40)</b> As a Coordinator, Organized “AZADI-70” in the Dept. of Sanskrit &amp; Indian Culture of Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, on 18th-19th August 2016.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2413" class="elementor-tab-title" data-tab="3" role="button" aria-controls="elementor-tab-content-2413" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">TEACHING</a>
					</div>
					<div id="elementor-tab-content-2413" class="elementor-tab-content elementor-clearfix" data-tab="3" role="region" aria-labelledby="elementor-tab-title-2413"><p>M.A, Acharya, MCA, M.Phil</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2414" class="elementor-tab-title" data-tab="4" role="button" aria-controls="elementor-tab-content-2414" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">RESEARCH </a>
					</div>
					<div id="elementor-tab-content-2414" class="elementor-tab-content elementor-clearfix" data-tab="4" role="region" aria-labelledby="elementor-tab-title-2414"><p>Books Published<br /><b>1)</b> Hitopadesha, Self Publication with the Permission of SCSVMV Deemed University, 2011.<br /><b>2)</b> Rādheya, The Banaras Mercantile Company, Kolkatta, 2012, ISBN- 81-86359-31-1.<br /><b>3)</b> Concept of Kingship in Kalidasian Dramas, New Bharatiya Book Corporation, Ansari Road, Daryaganj, New Delhi, 2014, ISBN-978-81-8315-235-8.<br /><b>4)</b> Srivyasavacanabhagavatam, Dept. of Sanskrit &amp; Indian Culture, SCSVMV University, Enathur,Kanchipuram, 2015, U.P.-33<br /><b>5)</b> Studies in the Kumarasambhavam &#8211; with Special Reference to Yogic Practice, New Bharatiya Book Corporation, Ansari Road, Daryaganj, New Delhi, 2016, ISBN-978-81-8315-291-4</p><p>Editorial Experience<br />Granthadeepika Series – I &amp; II published (rare manuscripts)<br />Editor, Special Magazine “Chetana”<br />Editor, Students Newsletter “Kalpalata”</p><p>Projects Undertaken<br />Subhasitas in PanchaMahakavyas, SCSVMV Deemed University, Minor, January 2014.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2415" class="elementor-tab-title" data-tab="5" role="button" aria-controls="elementor-tab-content-2415" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">PUBLICATIONS</a>
					</div>
					<div id="elementor-tab-content-2415" class="elementor-tab-content elementor-clearfix" data-tab="5" role="region" aria-labelledby="elementor-tab-title-2415"><p><b><span style="color: #777777; font-family: Arial; font-size: small;">1)</span></b> Science in Human life published in Science Vision in the year 2003-04.<br /><b>2)</b> Prathamadarsane published in Sauvarnika in the year 2006<br /><b>3)</b> Mridu Paniyam published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during September 2006<br /><b>4)</b> Sanskrit and Phase Structure Grammar published in Vijnana Bharati, Bangalore, in the year 2006<br /><b>5)</b> Ramayane Astrasastrani, published in Raka,- the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during March 2007<br /><b>6)</b> Astangayoga in Kumarasambhavam, published in the journal The Vikrama, Vikrama University , Ujjain, in the Vol.XIV in the year 2007<br /><b>7)</b> Maharshi Sri Aravindakritam Santi Chathushthayam published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture, SCSVMV University during October 2008<br /><b>8)</b> Purusartha-s in Mahabharata published in Dimensions of Contemporary Sanskrit Research, New Bharatiya Book Corporation, New Delhi in the year 2008<br /><b>9)</b> Atanke Lalgadah published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during April 2009<br /><b>10)</b> Caritram published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during June 2010<br /><b>11)</b> Prachine Bharate Guruh published in Samskritshree during September 2010<br /><b>12)</b> House planning and Building Byelaws – in the light of Samaranganasutradhara published in the journal Visvabharati , Dept. of Sanskrit, Pondicherry University, in Vol- I during January 2011<br /><b>13)</b> Charitrikavikase Bharatiyasamskrith published in Samskritshree during February 2011<br /><b>14)</b> Concept of Dharma in Ramayana published in the journal Vijnanajhari, Dept. of Sanskrit &amp; Indian Culture, SCSVMV University, Kanchipuram in Vol- I with ISSN-2231-5195 during the year 2011.<br /><b>15)</b> Vedic Plants for Healing published in the Proceeding of the international Seminar on Veda : the source of Science and Culture, Canara First Grade College, Mangalore, during December 2011.<br /><b>16)</b> Kalpalateva Vidya published in Samskritshree during August 2012<br /><b>17)</b> Concept of Dharma in the light of Adi Sankara published in Sumedhah Volume-II Part-II &#8211; A Commemoration Volume, Dept. of Sanskrit, Pali &amp; Prakrit, Visva Bharati University, Santiniketan with ISBN-81-7702-369-1 in the year 2012.<br /><b>18)</b>Sukanasopadese Nitivakyani published in Samskritshree during June 2013<br /><b>19)</b>Sukanasopadese Nitivakyani (cont…)published in Samskritshree during July 2013.<br /><b>20)</b> Concept of Educational foundation in Kaidasian Age ( With Special Reference to the Works of Kalidasa) published in the International journal of Current Research and Review (IJCRAR) Vol- I, Issue-4 with ISSN &#8211; 2347 -3215 during Dec. 2013.<br /><b>21)</b> Concept of Chemical Science in Vedic Literature published in the Proceeding of the National Seminar on Application of Ancient Sastras in Modern Sciences, Samskrita Shodha Samsthana, Sirsi &amp; St. Aloysis (Auto) College, Mangalore during January 2014.<br /><b>22)</b> Socio-political condition in Bhagavatapurana published in the journal Vijnanajhari, Dept. of Sanskrit &amp; Indian Culture, SCSVMV University, Kanchipuram in Vol- II with ISSN-2231-5195 during the month of August 2014.<br /><b>23)</b> Vishnuvigraha published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture, SCSVMV University during January 2015.<br /><b>24)</b> Purusottamajagannathasya Brahmaparivartanam published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture, SCSVMV University during June 2015.<br /><b>25)</b> State Administration in Kalidasian Dramas published in Manipradipah &#8211; A Commemoration Volume, Dept. of Sanskrit, Pali &amp; Prakrit, Visva Bharati University, Santiniketan with ISBN-81-86359-44-3 during the month of October 2015.<br /><b>26)</b> Purusartha and Trivarga published in Chetana &#8211; A Special Magazine of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during November 2016<br /><b>27)</b> Durdasha Bharatasya published in Raka &#8211; the News Letter of Dept. of Sanskrit &amp; Indian Culture,SCSVMV University during March 2016<br /><b>28)</b> Treatment in the light of Yajna published in Shrutishobha &#8211; A Research Journal of Samskritam &amp; Samskriti, Veda Vijnana Shodha Samsthanam(R), Channenahalli, Bangalore, with ISSN-2348-1102 in the month of April 2016.</p></div>
				</div>
							<div class="elementor-accordion-item">
					<div id="elementor-tab-title-2416" class="elementor-tab-title" data-tab="6" role="button" aria-controls="elementor-tab-content-2416" aria-expanded="false">
													<span class="elementor-accordion-icon elementor-accordion-icon-right" aria-hidden="true">
															<span class="elementor-accordion-icon-closed"><svg class="e-font-icon-svg e-fas-plus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H272V64c0-17.67-14.33-32-32-32h-32c-17.67 0-32 14.33-32 32v144H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h144v144c0 17.67 14.33 32 32 32h32c17.67 0 32-14.33 32-32V304h144c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
								<span class="elementor-accordion-icon-opened"><svg class="e-font-icon-svg e-fas-minus" viewBox="0 0 448 512" xmlns="http://www.w3.org/2000/svg"><path d="M416 208H32c-17.67 0-32 14.33-32 32v32c0 17.67 14.33 32 32 32h384c17.67 0 32-14.33 32-32v-32c0-17.67-14.33-32-32-32z"></path></svg></span>
														</span>
												<a class="elementor-accordion-title" tabindex="0">OTHERS</a>
					</div>
					<div id="elementor-tab-content-2416" class="elementor-tab-content elementor-clearfix" data-tab="6" role="region" aria-labelledby="elementor-tab-title-2416"><h4>Awards &amp; Achievements</h4><p><b>1)</b> Honoured with VikramaKalidasa Award-2005 from KalidasaSamiti, Vikrama University, Ujjain in the month of Nov. 2005<br /><b>2)</b> Honoured with Best Teacher Award-2013 from SCSVMV University, Kanchipuram on 5th Sept. 2013.<br /><b>3)</b> Honoured with Best Teacher Award-2015 from SCSVMV University, Kanchipuram on 5th Sept. 2015.<br /><b>4)</b> Honoured with Dr. APJ Abdul Kalam Award for Teaching Excellent-2015from Marina Labs, Chennai on 27th October 2015.<br /><b>5)</b> Honoured with Prof. JagdishSahiKulshresthaAwardfrom SamskritaShodhaSamsthana, Sirsi,Karnatak on 31st January 2016.<br /><b>6)</b> Honoured with Best Teacher Award-2016 from SCSVMV University, Kanchipuram on 26th Sept. 2016.</p><h2>FDPs, Seminars, Workshops</h2><p><b>1)</b> Attended Regional Seminar on “Sanskrit the protector of Indian Culture” Conducted by Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, in the year of 1999.<br /><b>2)</b> Attended and presented a paper in National Seminar on “Relevance of Sanskrit to Contemporary India” Conducted by the Dept. of Sanskrit Pondicherry University in the year of 2000.<br /><b>3)</b> Attended “Samskrtotsva”Organised by Sri Chandrasekharendra Saraswathi Viswa Mahavidyalaya (SCSVMV University) Kanchipuram, from the year 2000 to 2014.<br /><b>4)</b> Attended and presented a paper in “International Conference on Mahabharata”Organised by KanchiKamakotiPeetham at Vaishanava College for Women, Chennai on 23rd-26thDec, 2003. Topic- Purusharthas in Mahabharata<br /><b>5)</b> Attended and presented a paper in “International Ramayana Conference”Organised by Sri Venkateswara University at Tirupathi on 22nd-24thAug, 2004. Topic- Concept of Dharma in Ramayana<br /><b>6)</b> Attended and presented a paper in “Veda VignanaAnveshini Vedic symposium” Organised by National Institute of Vedic Sciences, Mulbagal, Bangalore on 20th-22nd Sept, 2004. Topic- Vedic Plants<br /><b>7)</b> Attended UGC- Refresher Course in Sanskrit, Organised by the Dept. of Sanskrit &amp; Indian Culture, SCSVMV University, Kanchipuram on 5th-25th Nov, 2004. Topic- Animal Ecology in Abhijnanasakuntalam<br /><b>8)</b> Attended Regional Seminar on “Intellectual Property Rights” sponsored by HRD, New Delhi and Organised by Dept. of Management Studies, SCSVMV University, Kanchipuram, on 09th-10th March, 2005.<br /><b>9)</b> Attended National Workshop on “Women and Children in Tsunami” at Madras School of Social Work, Chennai,Organised by ICSW-Tamilnadu on 30th July, 2005.<br /><b>10)</b> Attended and presented a paper in “All India KalidasaSamaroha”Organised by KalidasaSamiti, Vikrama University, Ujjain, on 12th-18thNov, 2005. Topic- Astangayoga in Kumarasambhavam<br /><b>11)</b> Attended UGC- Refresher Course in Sanskrit, Organised by the Dept. of Sanskrit &amp; Indian Culture, SCSVMV University, Kanchipuram, on15thDec, 2005 &#8211; 4thJan, 2006. Topic- Lord Jagannath- God for All<br /><b>12)</b> Attended and presented a paper in National Seminar on “Manuscriptology &amp; Paleography” Organised by SCSVMV University, Kanchipuram, on 11thFeb, 2006. Topic- An Introduction to Manuscriptology<br /><b>13)</b> Attended and presented a paper in National Seminar on “Bharatiya heritage in Engineering &amp; Technology”Organised by VijnanaBharati, Bangalore on 11th-13thMay, 2006. Topic- Sanskrit and Phase Structure Grammar<br /><b>14)</b> Attended National Seminar on “Facets of Consciousness” Organized by the Dept. of Management Studies, SCSVMV University, Kanchipuram,on 2nd-3rdMarch, 2007.<br /><b>15)</b> Attended a Workshop on “Unfinished Agenda for Youth” Organized by the Rajiv Gandhi National Institute of Youth Development, Sriperumbudur,on 29thOctober, 2007.<br /><b>16)</b> Attended a Workshop on “Principles of pre-natal Education in Vedic Culture” Organized bySri Aurobindo Society, Pondicherry on 4thNovember, 2007.<br /><b>17)</b> Attended and presented a paper in National Seminar on “Jivanmuktas of Bharata” Organized by YogiramsuratakumarAshrama, Thiruvannamalai on 2nd &#8211; 3rdFeb, 2008. Topic-Jivanmukta- An Understanding<br /><b>18)</b> Attended and presented a paper in National Seminar on “Social relevance of Sanskrit” Organized by the Dept. ofSanskrit, PandicherryUniversity, Kalapet,Pondicherry on11th &#8211; 13th Feb, 2008. Topic- Administration in Kalidasian Dramas<br /><b>19)</b> Attendeda Workshop on “Automatic Processing ofThe Natural Language” Organised byDepartment of Sanskrit , SCSVMV University,Kanchipuram, on 16th &#8211; 17thFeb, 2008.<br /><b>20)</b> Invitedas Chief Guest to inaugurate “Ashoka Social Science Club” and delivered a lecture on “Human Value” at Maharshi International School, Sunguvachatram on 31stJuly, 2009.<br /><b>21)</b> Attended and presented a paper in National Seminar on “Emerging Trends and Challenges for Higher Education in India” Organized by the School ofEducation, SCSVMV University,Kanchipuram, on 21stFeb, 2009. Topic-Challenges for Higher Education in India<br /><b>22)</b> Attended and presented a paper in “All India KalidasaSamaroha”Organised by KalidasaSamiti, Vikrama University, Ujjain,from 29thOct &#8211; 4thNov, 2009. Topic-Kalidasa – A Spiritual Master<br /><b>23)</b> Attended National Seminar on “Emerging Research Trends in Basic Sciences” Organized by SankaraVigyanaParishada, SCSVMV University,Kanchipuram, on 19thMarch, 2010.<br /><b>24)</b> Attended and presented a paper in “All India Oriental Conference” Organised by Rastiya Sanskrit Vidyapeetha, Tirupati, from 2ndJuneto 4thJune, 2010. Topic &#8211; Socio-palitical Condition in Bhagavatapurana<br /><b>25)</b> Attended and presented a paper in “International Seminar on VastuShastra&amp; Allied Sciences” Jointly Organized by VsatuSadan, NewDelhi and Dept. of Veda, BHU,Varanasi, in New Delhi on 23rd-25thJuly, 2010. Topic-House Planning and Building Byelaws – in the light ofSamaranganasutradhara<br /><b>26)</b> Attended and presented a paper in “National Seminar on Science and Technology in Samskrit” Jointly Organized by the Dept. of Sanskrit &amp; Indian Culture of SCSVMVUniversity, Kanchipuram and Sri Sankara arts &amp; Science College, Kanchipuramon 10th-11thMarch, 2011. Topic-Medical Science in Vedic literature<br /><b>27)</b> Attended and presented a paper in “National Seminar on AdiSankar and his Message” Organized by AdiSankara Studies Centre, SCSVMVUniversity, Kanchipuram on 25th-26thApril, 2011. Topic-Concept of Dharma in the light of AdiSankar<br /><b>28)</b> Attended and presented a paper in “International Seminar on Veda: the source of Science and Culture- An Universal Approach “Organized by Canara First Grade College, Mangalore on 14th-17thDecember, 2011. Topic-Vedic Plants for Healing<br /><b>29)</b> Attended and presented a paper in “International Seminar on PuriJagannathChetana(Consciousness) Globalisation- A Prospect” Organized by Dept. of Mordern Subjects(History), SreeSadashiv Campus, Rastriya Sanskrit Samthan(DU), Puri on 15th-17thJanuary, 2012. Topic- PurusottamaJagannath &#8211; An Universal God<br /><b>30)</b> Attended a National Workshop on “Bhattarahasya of Khandadeva”Organised byDepartment of Sanskrit,SCSVMV University,Kanchipuram, on 12th &#8211; 14thFeb, 2013.<br /><b>31)</b> Attended ICPR Sponsored Periodical Lecture Series Programme on “Debate Between Nyaya and Vedanta Relating Nature Etc. of Knowledge” Organised byDepartment of Sanskrit,SCSVMV University,Kanchipuram, on 18thApril, 2013.<br /><b>32)</b> Attended and presented a paper in a National Seminar on “Sanskrit for Children” Organized bySri Aurobindo Society, Pondicherry collaboration with Rastriya Sanskrit Samsthan, New Delhion 13th-14thApril, 2013. Topic-Storytelling in Sanskrit for Childern<br /><b>33)</b> Attendedand presented a paper in a National Seminar on “Sciences and Social Sciences Depicted in Puranas” Organized bySamskritaShodhaSamsthana, Sirsi, Karnataka, on 8th-10thMay, 2013. Topic-Elements of Purana on Universe &#8211; An Understanding<br /><b>34)</b> Attendedand presented a paper in an International Seminar on “Mahabharata” Organized bySri Vadiraja Research Foundation, Udupi, Karnataka, on 17th-19thMay, 2013. Topic-Mahabharata and Veda<br /><b>35)</b> Attended a Workshop on “Yoga and Emotional Health” Organised byResearch Department,Krishnamacharya Yoga Mandiram, Mandavali, Chennai on 23rdNovember, 2013.<br /><b>36)</b> Attendedand presented a paper in National Seminar on “Philosophical Foundations of Education in AncientIndia and its Relevance to Present Day Context” Organized bySchool of Education, SCSVMV University, Kanchipuram, on 29th-30thNov, 2013. Topic-Educational Foundation in Kalidasian Age (with Special References to the works of Kalidasa)<br /><b>37)</b> Attended and presented a paper in “International Seminar on PuriJagannathChetana(Consciousness) Globalisation- A Prospect” Organized by the Council of Cultural Relations, Marchikote, Puri on 7th-9thDec, 2013. Topic-JagannathacetanaAnd Swami Vivekananda<br /><b>38)</b> Attended and presented a paper in National Seminar on “Application of Ancient Sastras in Modern Sciences” Jointly Organized by SamskritaShodhaSamsthana, Sirsi and SamskritaSangha, St. Aloysius (Auto) College, Mangalore on 18th-19thJanuary 2014. Topic-Concept of Chemical Science in Vedic literature<br /><b>39)</b> Attended and presented a paper in National Seminar on “Personality Development for Sanskrit Student” Organized by Career Counseling Cell (Sponsored by UGC) of Rastriya Sanskrit Vidyapeetha, Tirupati during 8thAISSTF-2014 on 23rdJanuary, 2014. Topic-SamskritavidyarthinamVyaktitvavikasaparikalpana Attended ICPR Sponsored Periodical Lecture Series Programme on “Evolution on Vedanta thought” Organised byDepartment of Sanskrit, SCSVMV University,Kanchipuram, on 12thFebruary, 2014.<br /><b>40)</b> Attended and presented a paper in National Seminar on “Rasa Theory” Organized byDepartment of Sanskrit &amp; Indian Culture,SCSVMV University,Kanchipuram, on 27th -28thMarch 2014. Topic-UpanisatsuRasasvarupam<br /><b>41)</b> Attended and presented a paper in UGC Sponsored National Seminar on “Relevance of Upanisads in Modern Days” Organized by Department of Sanskrit, S.B.Arts and K.C.P. Science College, Bijapur on 6th-7thSeptember, 2014. Topic-Educational Elements as reflected in Upanisads<br /><b>42)</b> Attended and presented a paper in UGC Sponsored National Seminar on “Swami Vivekananda: The Voice of the Youth” Organized byDepartment of English, S.B.Arts and K.C.P. Science College, Bijapur on 6th-7thSeptember, 2014. Topic-Swami Vivekananda on Youth (with Special reference to the Education)<br /><b>43)</b> Attended and presented a paper in National Seminar on “Historicity of Ramayanam” Organized by BharatiyaItihasaSamkalanaSamitiAndhrapradesh ,Ongole on 8th-9thNovember, 2014. Topic-Social Status as depicted in Ramayana<br /><b>44)</b> Attended and presented a paper in UGC Sponsored National Seminar on “Moral Values Depicted in Sanskrit literature” Organized by Dept. of Sanskrit, Poornaprajna College and Mangalore University Sanskrit Teachers’ Association, Udupi, Karnataka,on 19th-20thDecember, 2014. Topic-Moral Values as reflected in the characters of Abhijnanasakuntalam<br /><b>45)</b> Attended as an observer in National Seminar on “Shastric and Prayogic Elements of Agamas” Jointly organized by Dept. of Sanskrit &amp; Indian Culture and Indira Gandhi National Centre for the Arts, New Delhi on 7th-8th January, 2015.<br /><b>46)</b> Attended ICPR Sponsored Periodical Lecture Series Programme on “Nature and Validity of MimamsaSastra”Organised byDepartment of Sanskrit,SCSVMV University, Kanchipuram, on 27thFebruary, 2015.<br /><b>47)</b> Attended and presented a paper in International Conference on “Relevance of Yanja for a Healthy Society”Organized by Veda VijnanaShodhaSamsthanam,Chennenahalli, Bengaluru on 28thFebruary &#8211; 2ndMarch, 2015. Topic- Treatment in the light of Yajna<br /><b>48)</b> Attended and presented a paper in National Seminar on “Women in Sanskrit Literature”Organized by Dept. of Sanskrit, Queen Marry’sAutonomus College, Chennai on 3rdMarch, 2015. Topic- Position of Women in Kalidasian Dramas<br /><b>49)</b> Attended and presented a paper in National Seminar on “Science &amp; Information Technology in Sanskrit Literature”Organized by Dept. of Sanskrit, Anandapur College, Anandapur, Orissa on 11th&amp; 12thJuly, 2015. Topic- Science in Sanskrit &#8211; An Observation<br /><b>50)</b> Attendedand presented a paper in a National Seminar on “Modern Trends in Sanskrit Studies And Research” Organized bySamskritaShodhaSamsthana, Sirsi,and Sri Durga Centre for PG Studies and Research in Sanskrit, Kateel, Karnataka, on 30th-31stJanuary, 2016. Topic- Status of the Teacher in the light of Vedic Literature <b>51)</b> Attended ICPR Sponsored Periodical Lecture Series Programme on “Influnce of Yogasastra on Nyayamanjari and Nyayabhusanam”Organised byDepartment of Sanskrit,SCSVMV University,Kanchipuram, on 25thFebruary 2016.<br /><b>52)</b> Attended and presented a paper in a National Seminar on “Continuing Creative efforts for the Sustenance of Sanskrit” Organised byDepartment of Sanskrit,SCSVMV University,Kanchipuram, on 3rd-4thMarch, 2016. Topic-Contribution of Prafulla Kumar Mishra to the Mordern Sanskrit Poetry<br /><b>53)</b> Attended National Seminar on “Vrttivimarsah”Organised byDepartment of Sanskrit,SCSVMV University,Kanchipuram, on 19th-20thApril, 2016.<br /><b>54)</b> Attended one day Workshop on “Writing of Proposal for funded Projects” Organized by Centre for Development of Teaching and Learning, SCSVMV University, Kanchipuram, on 29thAugust 2016.<br /><b>55)</b> Attended an International Conference on “Trends and Development in ELT” Organized by Department of English, SCSVMV University, Kanchipuram, on 31stAugust 2016.<br /><b>56)</b> Attended an International Conference on “Recent Trends, Advancement and Applications in Digital Image Processing” Organized byDepartment of Computer Science&amp; Engineering, SCSVMV University,Kanchipuram, on 14th-15thOctober 2016.<br /><b>57)</b> Attended and presented a paper in a National Seminar on “Sri Aurobindo and Sanskrit” Organized bySri Aurobindo Society, Pondicherry on 26thOctober, 2016. Topic- Integral Education of Sri Aurobindo</p></div>
				</div>
								</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				<section class="elementor-section elementor-top-section elementor-element elementor-element-a799d8b elementor-section-boxed elementor-section-height-default elementor-section-height-default wpr-particle-no wpr-jarallax-no wpr-parallax-no wpr-sticky-section-no wpr-column-slider-no wpr-equal-height-no" data-id="a799d8b" data-element_type="section" data-e-type="section">
						<div class="elementor-container elementor-column-gap-default">
					<div class="elementor-column elementor-col-100 elementor-top-column elementor-element elementor-element-87b58a1" data-id="87b58a1" data-element_type="column" data-e-type="column">
			<div class="elementor-widget-wrap elementor-element-populated">
						<div class="elementor-element elementor-element-d3e8b25 elementor-widget elementor-widget-spacer" data-id="d3e8b25" data-element_type="widget" data-e-type="widget" data-widget_type="spacer.default">
				<div class="elementor-widget-container">
							<div class="elementor-spacer">
			<div class="elementor-spacer-inner"></div>
		</div>
						</div>
				</div>
					</div>
		</div>
					</div>
		</section>
				</div>
		</div><p>The post <a href="https://kanchiuniv.ac.in/team/dr-debajyoti-jena/">Dr.Debajyoti Jena</a> appeared first on <a href="https://kanchiuniv.ac.in">SCSVMV Deemed to be University</a>.</p>
]]></content:encoded>
					
		
		
			</item>
	</channel>
</rss>
